Protein Info for AMB_RS17040 in Magnetospirillum magneticum AMB-1

Annotation: dissimilatory-type sulfite reductase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 43% identical to DSRB_ARCFU: Sulfite reductase, dissimilatory-type subunit beta (dsrB) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K11181, sulfite reductase, dissimilatory-type beta subunit [EC: 1.8.99.3] (inferred from 100% identity to mag:amb3368)

MetaCyc: 70% identical to siroheme sulfite reductase, beta subunit (Allochromatium vinosum)
1.8.1.g [EC: 1.8.1.g]

Predicted SEED Role

"Dissimilatory sulfite reductase, beta subunit (EC 1.8.99.3)" (EC 1.8.99.3)

MetaCyc Pathways

sulfur oxidation IV (intracellular sulfur) (5/7 steps found)
dissimilatory sulfate reduction I (to hydrogen sufide)) (3/5 steps found)
superpathway of sulfide oxidation (phototrophic sulfur bacteria) (8/12 steps found)
superpathway of tetrathionate reduction (Salmonella typhimurium) (2/4 steps found)
superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (3/6 steps found)

KEGG Metabolic Maps

Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.99.3

Use Curated BLAST to search for 1.8.1.g or 1.8.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1V3 at UniProt or InterPro

Protein Sequence (356 amino acids)

>AMB_RS17040 dissimilatory-type sulfite reductase subunit beta (Magnetospirillum magneticum AMB-1)
MSELRRPVECGVPDSKQFMHPALVRNYGQWAFHDRPRPGVLRHVSDSGEAVYTVKAGTQR
QMDVHTIRALCDIADTFCDGHVRFTVRSSVEFMTTDEAKVAPLIERLEKDGFPVGGTGNS
VGFISHTQGWLHCDIPGTDASGVVKALMDELVDEFKSEEMPNRVKITTSCCQINCGGQGD
IAINVQHTKPPVINHALVAGVCERPAVIARCPVAAIRPALVDGKPSLEVDEKKCVCCGAC
YPPCPPMQINDPVHSKIAIWVGGKHSSTRSKPMFHKLVAAGLPNNAPRWPEVAEVVKKIL
AVYKADARAWERMGEWIERIGWPRFFELTELPFTKYHVDNWRGGRANLNASAHLHF