Protein Info for AMB_RS16975 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome c oxidase accessory protein CcoG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 35 to 463 (429 residues), 452 bits, see alignment E=1.1e-139 PF12801: Fer4_5" amino acids 96 to 129 (34 residues), 27.1 bits, see alignment (E = 1.3e-09) PF13746: Fer4_18" amino acids 218 to 321 (104 residues), 127.6 bits, see alignment E=1.1e-40 PF11614: FixG_C" amino acids 357 to 479 (123 residues), 106.1 bits, see alignment E=5.5e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3355)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1W6 at UniProt or InterPro

Protein Sequence (481 amino acids)

>AMB_RS16975 cytochrome c oxidase accessory protein CcoG (Magnetospirillum magneticum AMB-1)
MSMLGKTPQPSPACSATPAYAASAKIHPRGVKGRYRSFKWWASVLLLAYWHLAPLIRWDR
GPGAPSQAILADMAGRRGYFFFIEIWPQEVYFLTGLLFFAAIALFLMTSLVGRVWCGFLC
WQTVYTDLFVAVERLVIGERNQRIAFDRAPLSAGKLAKKALVNVIWLAIAAACGIGFTLY
FGDAFEMLRDIFTGQASTATYGAIAVVGGLCFLLAGYAREQVCIYMCPYARFQSAMFDEH
SLIISYEAWRGEARGPAPANRDFTGRGHCVDCLACVQACPTGIDIRNGNQLACIGCGLCI
DACNQVMDRFKLPHGLVSYDSSANLAARGEGRSGGLRLIRPRTLAYGAILALVASVMLFR
LTTRPDVDVNVLHERAPLFVQMSDGSIRNGYVYKILNMKSEDRTFKLRLAGIEGATITVV
GGEDSVAEAEMQVPRDSVGSFRLYVTIPADKVVSKSMPVSFQLTGPGRQVKTETLFAGPD
R