Protein Info for AMB_RS16745 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 782 transmembrane" amino acids 69 to 92 (24 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details PF13675: PilJ" amino acids 92 to 151 (60 residues), 32 bits, see alignment 4.5e-11 TIGR00229: PAS domain S-box protein" amino acids 278 to 402 (125 residues), 80.1 bits, see alignment E=7.7e-27 PF00989: PAS" amino acids 283 to 375 (93 residues), 47.2 bits, see alignment E=8.6e-16 PF13188: PAS_8" amino acids 284 to 329 (46 residues), 28.4 bits, see alignment 4.5e-10 PF08448: PAS_4" amino acids 286 to 395 (110 residues), 30.5 bits, see alignment E=1.5e-10 PF13426: PAS_9" amino acids 291 to 393 (103 residues), 40 bits, see alignment E=1.6e-13 PF00512: HisKA" amino acids 412 to 473 (62 residues), 36.3 bits, see alignment 1.9e-12 PF02518: HATPase_c" amino acids 524 to 640 (117 residues), 68.8 bits, see alignment E=2.1e-22 PF00072: Response_reg" amino acids 665 to 772 (108 residues), 39.2 bits, see alignment E=2.7e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3313)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W208 at UniProt or InterPro

Protein Sequence (782 amino acids)

>AMB_RS16745 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MKSERPREALLFFGVKIMPDYSGLLGMRHFNENPHTHRSLNSNYHRIIAMQGARISANKL
IASLTKRQAIVLVSLFILASSGFGALEFAVSFLSDDGAIINMAGRQRMLSQRVVSLGYQI
ITSPSDEAKQSVRSNMENAVASMEAEHQRLIEISVGRGMSNELNALYFGRAPTLDKSISY
FIKRARYFMDLELSGDDRRLPLIVLYDIAMMSRVELLQGLESVVSRYQFESQERANRLLY
SAFIGLLIFTFVLAFSWAGVFRPLARKLREELDAHQVSEEVKSSILDAALDAIVTIDGNG
AIIEFNPAAERIFGHLEQDVVGKEIADLIIPEQHRAAHRAGIARVIDGGVTKVIGQRLEM
HGLHADGHEIPLELAITQLPTHGLFTGFIRDLTGQKRTEEALRRSQKLEAVGQLTGGIAH
DFNNLLGIITGNLELLQKNLANDEKANRRLDTALKSARRGADLTRRLLAFSRQAPTVVGN
DPIDINDAVTGMLDMLQRSLTQIVQVKTKLDPALWKTVVNRSEFEDALLNLAINARDAMP
DGGTLAIETSNIVVEAEHARFDPNLQPGEYIVLMVSDSGTGISKDIVDKIFEPFFTTKER
GKGTGLGLSMVYGFARRSGGHVRVYSELGVGTAFRLYFPRSHAHVADPGQIGTETSDIPR
GTETVLVIDDELHLAEIAGEFLSDLGYAPIITTDTSEAVRLLKERSDIDLIFSDVVMPGG
LDGFGLAKLATDLGRKVLLTSGFTGYAHQHQNDGGFSVISKPYSKADLARMVRTILDGSD
GS