Protein Info for AMB_RS16710 in Magnetospirillum magneticum AMB-1

Annotation: recombinase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF00239: Resolvase" amino acids 3 to 135 (133 residues), 155 bits, see alignment E=1.5e-49 PF02796: HTH_7" amino acids 138 to 181 (44 residues), 35.3 bits, see alignment 1e-12

Best Hits

Swiss-Prot: 48% identical to BINR_STAAU: Transposon Tn552 DNA-invertase BinR (resR) from Staphylococcus aureus

KEGG orthology group: None (inferred from 100% identity to mag:amb3309)

MetaCyc: 52% identical to e14 prophage; site-specific DNA recombinase (Escherichia coli K-12 substr. MG1655)
5.99.1.-

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W212 at UniProt or InterPro

Protein Sequence (194 amino acids)

>AMB_RS16710 recombinase family protein (Magnetospirillum magneticum AMB-1)
MFVGYARVSTQDQSPQLQLDALHAAGCERIFSEHASGARADRPELKAALDFARNGDTVVV
WKLDRLARSTRQLIETVDMLDGRGIGLRSLTEAIDTTTAGGKLIFHVFAALGEFERSLII
ERTRAGLDSARKMGRVGGRPRSLSGQDVEVARAMLASPAITVEEVARRLNVSTATLYRHL
PGGRGGGLDLRPAG