Protein Info for AMB_RS16605 in Magnetospirillum magneticum AMB-1

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 transmembrane" amino acids 81 to 102 (22 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details PF12974: Phosphonate-bd" amino acids 106 to 355 (250 residues), 109.3 bits, see alignment E=3.1e-35 PF00512: HisKA" amino acids 445 to 511 (67 residues), 35.4 bits, see alignment E=1.4e-12 PF02518: HATPase_c" amino acids 557 to 665 (109 residues), 80.8 bits, see alignment E=1.5e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3291)

Predicted SEED Role

"Tetrathionate reductase sensory transduction histidine kinase" in subsystem Tetrathionate respiration

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W230 at UniProt or InterPro

Protein Sequence (670 amino acids)

>AMB_RS16605 sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MLRACCATTSDSSSAMISWWDRRISRATRRRLASSVSSVISAHPFPAAGHRRAAAYCVPL
GAQSRPAFLGLAVCCPFGQSLAMVFRLFLICCLLTCSGAFAAEVRIGVLAFQGAERALRT
WEPTAAHLNRSVGGSRFVLVPLDLDAMSRAVAGREVDFVITNPGNYIALESGFGATRLVT
VESERSGSPIAAIGSTVVARGDRPDLDTLAGLKGRRLAVVSTEAFGGYQVLWRELAALGL
DPSDDLREIRQTGFPMERVAQLVRDGLVDAGVLRACLLEEMIAEGALAPGELRVVGRRDE
PKLPCAVSSRLYPDWPFAKLAETSHDLAKQVAAALLSMPAVDGQAWTAPQDYTQVHALMQ
DLEIGPYAHLRQHLNLAELARRHWQWLVIAAMAVLWWVVHVARVEVLVRRRTAELEREIA
ERERAENDAARHRAERDQFSRLGILGEMASNIAHELNQPLAAIMNYARGMSRMLDGGQAD
PAMLADGAQAVATQAERAAAIIQRIRGFVRRRKPRRERLDINEVVAETLALFESLAGRRG
IAVHVHLAEGLPGVSVDRGEIQQVLLNILQNAVDATAGQGAEAGDGITVRTSPGEGGVKV
AVRDCGAGLSQEAEARLFEPFFTTKPEGLGLGLSICRTIIEAHGGRLWASANPRRGLTLR
FVIPPAEAPA