Protein Info for AMB_RS16595 in Magnetospirillum magneticum AMB-1

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF12838: Fer4_7" amino acids 51 to 113 (63 residues), 27.2 bits, see alignment E=1.8e-09 PF13247: Fer4_11" amino acids 91 to 184 (94 residues), 99.7 bits, see alignment E=3.9e-32 PF13237: Fer4_10" amino acids 94 to 140 (47 residues), 26.8 bits, see alignment 1.6e-09 amino acids 122 to 175 (54 residues), 24.9 bits, see alignment E=6.3e-09 PF12797: Fer4_2" amino acids 121 to 141 (21 residues), 28.1 bits, see alignment (E = 5.4e-10) PF00037: Fer4" amino acids 123 to 143 (21 residues), 31.5 bits, see alignment (E = 4.5e-11)

Best Hits

Swiss-Prot: 58% identical to TTRB_SALTY: Tetrathionate reductase subunit B (ttrB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08358, tetrathionate reductase subunit B (inferred from 100% identity to mag:amb3289)

MetaCyc: 58% identical to tetrathionate reductase beta subunit (Salmonella enterica enterica serovar Typhimurium)
1.21.99.M4 [EC: 1.21.99.M4]

Predicted SEED Role

"Tetrathionate reductase subunit B" in subsystem Tetrathionate respiration

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.21.99.M4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W232 at UniProt or InterPro

Protein Sequence (242 amino acids)

>AMB_RS16595 4Fe-4S dicluster domain-containing protein (Magnetospirillum magneticum AMB-1)
MTHSRRDLLKGMGRITAGAVAVAAIPAAAEAAASPGGDPARRWAMVVDLGKCIGCQACTI
GCIMENRVPADSFRTFVSTYEVTEGDKVGTYVLPRLCNHCSDPPCVGVCPVGATFQQKDG
AVMVDSDRCVGCAYCVQACPYDARFINHETNTADKCTFCGHRVAAGLLPACVETCVGGAR
VFGDLNETEGAVRRLLDANKGRTKVLKPEQGTAPNVYYIGLDERFAGRVDGTPTLWRPSS
HV