Protein Info for AMB_RS16490 in Magnetospirillum magneticum AMB-1

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 698 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details PF02203: TarH" amino acids 3 to 148 (146 residues), 63.3 bits, see alignment E=6.8e-21 PF12729: 4HB_MCP_1" amino acids 5 to 183 (179 residues), 99.7 bits, see alignment E=3.7e-32 PF00672: HAMP" amino acids 207 to 258 (52 residues), 33 bits, see alignment 1.6e-11 PF00015: MCPsignal" amino acids 362 to 523 (162 residues), 116.7 bits, see alignment E=2.6e-37 TIGR02481: hemerythrin-like metal-binding domain" amino acids 568 to 692 (125 residues), 102.4 bits, see alignment E=9.3e-34 PF01814: Hemerythrin" amino acids 576 to 690 (115 residues), 56.7 bits, see alignment E=9.1e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3267)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W254 at UniProt or InterPro

Protein Sequence (698 amino acids)

>AMB_RS16490 HAMP domain-containing protein (Magnetospirillum magneticum AMB-1)
MSLSNLRISMRLSILTGVLCIALVTTIFLGRSGMLSILNSLHTVYEDRTVCLVQLGTMQR
NLFRIRVRLLKMLDLNAYDATMVAQIADAEEIINKEWKAYLTTELAAEEKVIADKIKTAL
PDYLSEKNKVIELLKANDPDKATSLANGPALQKFMHLDEQIVANIELQERIAKEEYEEGK
ASASQKINFSLTLGGLALALGAAIAFVIARSITGPVNGIKGCMEQLTAGNLSAEVPGVDR
GDELGQMAKAVGVFKEGLLRVKEMEAEQEAQKARAEAERKAAMRQLANTFEGSVGKVIQT
VTSAATQLQVSSTQMASTAAETSAQATTVASASQQASANVETVAAATEELSSSITEIAKQ
VERSQSVASRAQDEAANTNVQIRALSENANKIGEIVNLINDIASQTNLLALNATIEAARA
GDAGKGFAVVANEVKHLATQTGKATEEIASQIRAVQDGTNNAVHAIDGITKVISEMGEIS
ASVASAVEEQAAATQEIARNVEQAAAGTAEVSSSVVTVEQAARDTGAAAEQIHSAATDLS
QQSEFLRAEVGRFLDQVRSDQSDVKLLNWDNALNMGIGNIDRHHREMFDEVNRLYAKMSQ
GNGAEAGQGMITLIDTVMGSHFREEEEVMSRNSYPHLDEHRRHHRDFLDRAKSHKGAVQS
GDPTAAAKMFEYVATWLTNHIQMEDGKLANYLKAKKVA