Protein Info for AMB_RS16385 in Magnetospirillum magneticum AMB-1

Annotation: fructose-6-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00875: fructose-6-phosphate aldolase
  • amino acids 1 to 212 (212 residues), 283.2 bits, E=5.4e-89
• PF00923: TAL_FSA
  • amino acids 3 to 216 (214 residues), 215.3 bits, E=6.1e-68

Best Hits

Swiss-Prot: 74% identical to TAL_RHOCS: Probable transaldolase (tal) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 74% identity to rce:RC1_2255)

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

• Rubisco shunt (10/10 steps found)
• Bifidobacterium shunt (13/15 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• pentose phosphate pathway (5/8 steps found)
• superpathway of glucose and xylose degradation (11/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Protein Sequence (218 amino acids)

>AMB_RS16385 fructose-6-phosphate aldolase (Magnetospirillum magneticum AMB-1)
MKFFIDTAEVAEIRELAATGLVDGVTTNPSLIAKSGRKILDVIAEICDIVPGPISAEVAA
TDFDTMLAEGRKLAALRPNVAVKVPLTPAGLKTCKVLSDDGVRVNVTLCFSANQAILAAK
AGAAFISPFVGRLDDIGQDGMELIADIVSIYREYPAFRTEVLAASIRHPMHVTEAARLGA
HVVTMPAAVLRQMYQHPLTDKGLAAFMADWAKTGQSIL