Protein Info for AMB_RS16365 in Magnetospirillum magneticum AMB-1

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 76.2 bits, see alignment E=2.2e-25 PF00486: Trans_reg_C" amino acids 146 to 220 (75 residues), 65.9 bits, see alignment E=2.8e-22

Best Hits

Swiss-Prot: 44% identical to Y4XI_SINFN: Probable transcriptional regulatory protein y4xI (NGR_a00800) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to mag:amb3243)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W278 at UniProt or InterPro

Protein Sequence (225 amino acids)

>AMB_RS16365 DNA-binding response regulator (Magnetospirillum magneticum AMB-1)
MRILLVEDNDRLAEFISAGLKSAGFVPDVFGTVADATAAFESAAYQAAILDLGLPDGDGL
DIVRAQRAKAAPCPIMVLTARDRVSDRVSGLNAGADDYLLKPFAMEELIARLRAILRRPG
AALSVELSLGNLTFDTAGREVRVDGQLVAMPRREMEMLEHLLRRSGKVVSKRSLEEGLYG
FDDDVTPNSVEVLVSRLRKRLQQTGAGVTVHTLRGIGYMLADGAS