Protein Info for AMB_RS16280 in Magnetospirillum magneticum AMB-1

Annotation: 5-formyltetrahydrofolate cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details PF01812: 5-FTHF_cyc-lig" amino acids 10 to 184 (175 residues), 112.2 bits, see alignment E=1.5e-36 TIGR02727: 5-formyltetrahydrofolate cyclo-ligase" amino acids 10 to 184 (175 residues), 138.5 bits, see alignment E=1.1e-44

Best Hits

KEGG orthology group: K01934, 5-formyltetrahydrofolate cyclo-ligase [EC: 6.3.3.2] (inferred from 50% identity to nha:Nham_3528)

Predicted SEED Role

"5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2)" in subsystem Folate Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 6.3.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>AMB_RS16280 5-formyltetrahydrofolate cyclo-ligase (Magnetospirillum magneticum AMB-1)
MTEISPAPSKMELRRIARHTRREAAVRGPAAARALAGLADALGLAPAMVVAGYWPLGDEI
DPRPLMDALAARGHVLALPTVTQSGGILEFRPWSPGEALEPGPHGTWHPVARPPVGPQVL
LVPLLAFDTRGFRLGYGGGYYDRTLGQLRRDGAVCAIGLAFAAQEVDTVPTDPWDIALDL
IATEHGVIVTAAK