Protein Info for AMB_RS16240 in Magnetospirillum magneticum AMB-1

Annotation: tol-pal system-associated acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 TIGR02799: tol-pal system-associated acyl-CoA thioesterase" amino acids 57 to 183 (127 residues), 146.2 bits, see alignment E=6e-47 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 60 to 154 (95 residues), 103.3 bits, see alignment E=1e-33 PF13279: 4HBT_2" amino acids 66 to 182 (117 residues), 63.6 bits, see alignment E=2.4e-21 PF03061: 4HBT" amino acids 71 to 156 (86 residues), 63.4 bits, see alignment E=2e-21

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 100% identity to mag:amb3215)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2A6 at UniProt or InterPro

Protein Sequence (193 amino acids)

>AMB_RS16240 tol-pal system-associated acyl-CoA thioesterase (Magnetospirillum magneticum AMB-1)
MRRGNDGDGDSHPDDQREEGSHPAPPCRGRHHRSRRRSLACARDDRLGGRLVAVNAHTFP
VRVYYEDTDAGGIVYHSNYLKFAERARTEMVRELGISQRAMLEDGEGTAFAVRSANLDFR
RPAKLDDLLSVETQVISIGGASIELDQRIVRVDDGTELVHLEVRLGYITLSGKPARIPAP
VRDLFANRISERR