Protein Info for AMB_RS16235 in Magnetospirillum magneticum AMB-1

Annotation: protein TolQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details TIGR02796: protein TolQ" amino acids 19 to 235 (217 residues), 287.1 bits, see alignment E=4.8e-90 PF01618: MotA_ExbB" amino acids 104 to 223 (120 residues), 129.8 bits, see alignment E=2.7e-42

Best Hits

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 100% identity to mag:amb3214)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2A7 at UniProt or InterPro

Protein Sequence (241 amino acids)

>AMB_RS16235 protein TolQ (Magnetospirillum magneticum AMB-1)
MDPSQAVGAAGAAAQMDLSMWALFLRADIIVKFVMIALLMASFWCWAIIFDKLMKVRQLT
TRADQFEEAFWSGGSLEELYDRIGSRPLDPMSSIFVAAMREWRRSAAKGLADRDSTRASL
PQRIDRVMSVTLGREMELLERRLGFLASVGSTAPFIGLFGTVWGIMNSFQSIAATKNTSL
AVVAPGIAEALFATALGLVAAIPAVIAYNKISTDLDRYSKRLENFAGEFGAILSRQLEEK
A