Protein Info for AMB_RS16220 in Magnetospirillum magneticum AMB-1

Annotation: protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 22 to 443 (422 residues), 467.6 bits, see alignment E=1.9e-144 PF04052: TolB_N" amino acids 31 to 136 (106 residues), 122.9 bits, see alignment E=1.3e-39 PF07676: PD40" amino acids 247 to 281 (35 residues), 27.1 bits, see alignment 6.3e-10 amino acids 291 to 325 (35 residues), 40.2 bits, see alignment 4.7e-14

Best Hits

Swiss-Prot: 100% identical to TOLB_MAGSA: Tol-Pal system protein TolB (tolB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03641, TolB protein (inferred from 100% identity to mag:amb3211)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2B0 at UniProt or InterPro

Protein Sequence (447 amino acids)

>AMB_RS16220 protein TolB (Magnetospirillum magneticum AMB-1)
MITMSRIRSLAAFAVFVILGVAAVLPAQAEVRIDITRGQMKPLPIAIPDFAGASAQDNRM
GADIARVVSADLERSGLFKPIDPKAFIQNAASLQAGPRFPDWKAINAEALVSGKIESGAD
GRVRVEFRLWDVFNEAYMTGWTLSASPQDWRRLSHKVADAIYKRVTGEDGYFDTQIVYIA
ESGPKNDRKKRLSIMDQDGENHRFLTDGSELVLTPRFSPSAREITYLSYFKGVPRVYIFN
LDTGRRESLGNFPGMTFAPRFSPDGNKVVFSMAENGNTEIYEMNLLTRQKRQLTMNPAID
TAPSYSPDGQQIVFESDRGGGQQIYTMSADGSNPQRISFGDGRYGTPVWSPRGDLIAFTK
QKGGQFFIGVMRTDGSGERLLAEGFLVEGPTWAPNGRVLSFFRESPSDERGRGQVVRLYT
IDLTGVNERVLLTPVDGSDPAWSPLIP