Protein Info for AMB_RS16205 in Magnetospirillum magneticum AMB-1

Annotation: tol-pal system protein YbgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details PF13525: YfiO" amino acids 226 to 314 (89 residues), 26.3 bits, see alignment E=1.2e-09 TIGR02795: tol-pal system protein YbgF" amino acids 229 to 338 (110 residues), 108.1 bits, see alignment E=2e-35 PF13432: TPR_16" amino acids 232 to 298 (67 residues), 33.6 bits, see alignment E=8.8e-12 PF13174: TPR_6" amino acids 238 to 261 (24 residues), 13.1 bits, see alignment (E = 2.6e-05) amino acids 267 to 298 (32 residues), 13.6 bits, see alignment (E = 1.7e-05) amino acids 305 to 335 (31 residues), 16.7 bits, see alignment (E = 1.8e-06)

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3208)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2B3 at UniProt or InterPro

Protein Sequence (355 amino acids)

>AMB_RS16205 tol-pal system protein YbgF (Magnetospirillum magneticum AMB-1)
MRPWESHSSASVSKMRLVVRRFVLSTALSALLIGAAFVSPASAQSDTRALYDRIERLERD
LMTLQSQSARGGSTVVRSSANDGSVSGSAASRLEDRINELEDANRFLTGKIEEANFKAAQ
LNKQLERMQADIDLRFKDLEGGKGGSSSSAQPQSMSMPAASAPATTPSGAPVLIPPKGVK
PGANSADNDGPAPGPQNLGAMPAGALKKGEAEAQAQAAKAPPAAPKDAQSAYEEAYGLAQ
KGDYDGAEQGFRSFLKTYPNHQLAGNAQYWLGDIAFSQRKDFATSAKLFGEAYKKYPKHT
KAPDMLYKLGASFGHLDMKDQACRTYALLFAEHPDMADRIKRAATGDKQRLGCGK