Protein Info for AMB_RS16180 in Magnetospirillum magneticum AMB-1

Annotation: DUF4405 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details PF14358: DUF4405" amino acids 14 to 61 (48 residues), 36 bits, see alignment E=4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3202)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2B9 at UniProt or InterPro

Protein Sequence (170 amino acids)

>AMB_RS16180 DUF4405 domain-containing protein (Magnetospirillum magneticum AMB-1)
MNYFDNGLRRYATQATAVLSVVVGITGVILFFHLAKDPVEAIHEWLGMGFAAVAILHVIR
HRGSFALMLRQRQLHILAAITALGVAAFVALVPPKPSGNPMARLARAAEQAPISQLAPVM
GSRTEDVLARLRQAGINAEPGDSLAALAASHHVESVKLIALALPPSKRPN