Protein Info for AMB_RS16165 in Magnetospirillum magneticum AMB-1

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 3 to 135 (133 residues), 148 bits, E=2.9e-47
• TIGR01455: phosphoglucosamine mutase
  • amino acids 6 to 447 (442 residues), 637.6 bits, E=4.8e-196
• PF02879: PGM_PMM_II
  • amino acids 160 to 256 (97 residues), 57.3 bits, E=4e-19
• PF02880: PGM_PMM_III
  • amino acids 260 to 369 (110 residues), 128.8 bits, E=2.2e-41
• PF00408: PGM_PMM_IV
  • amino acids 376 to 444 (69 residues), 57.1 bits, E=3.1e-19

Best Hits

Swiss-Prot: 100% identical to GLMM_MAGSA: Phosphoglucosamine mutase (glmM) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to mag:amb3199)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• starch degradation V (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• glycogen degradation II (4/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• starch degradation III (2/4 steps found)
• starch biosynthesis (6/10 steps found)
• chitin biosynthesis (5/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (2/5 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• peptidoglycan recycling I (8/14 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• CMP-legionaminate biosynthesis I (3/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• streptomycin biosynthesis (3/18 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (7/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.10

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

See Q2W2C2 at UniProt or InterPro

Protein Sequence (451 amino acids)

>AMB_RS16165 phosphoglucosamine mutase (Magnetospirillum magneticum AMB-1)
MTRKLFGTDGIRGTANTDPMTAEMAMKLGMAAGRHFTRGDHRHVVVIGKDTRLSGYLLEP
ALTAGFISVGMDVVLLGPLPTPAVALLTRSMRADLGVMISASHNPYEDNGIKLFGPDGFK
LSDEDELTIEASMSNGLESCRVGSDHLGRAKRLDDAAGRYIEYAKYTFPRGLRLDGLKIV
VDCANGAAYKVAPTVLWELGAEVIPVAVNPDGFNINKNCGSLHTETMREQVVAHGAHLGI
ALDGDADRVVLCDELGHMIDGDQLMALIGDLWHRSGQLKGGGIVATVMSNLGLERFLDQR
GLKTIRTAVGDRYVLEHMRRDGFNVGGEQSGHIILSDHSTTGDGLVAGLQVLAALVQSGK
PASEMLRLFTPLPQVLKNVRVAKGSVAEVLAAPAVEAAIRDAEAKLAGQGRLLIRKSGTE
PLIRVMAEGEDEGLVEASVDAIVETIRRAAG