Protein Info for AMB_RS16165 in Magnetospirillum magneticum AMB-1

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 66 to 76 (11 residues), see Phobius details PF02878: PGM_PMM_I" amino acids 3 to 135 (133 residues), 148 bits, see alignment E=2.9e-47 TIGR01455: phosphoglucosamine mutase" amino acids 6 to 447 (442 residues), 637.6 bits, see alignment E=4.8e-196 PF02879: PGM_PMM_II" amino acids 160 to 256 (97 residues), 56.4 bits, see alignment E=8e-19 PF02880: PGM_PMM_III" amino acids 260 to 369 (110 residues), 127.8 bits, see alignment E=4.5e-41 PF00408: PGM_PMM_IV" amino acids 376 to 444 (69 residues), 57.3 bits, see alignment E=2.6e-19

Best Hits

Swiss-Prot: 100% identical to GLMM_MAGSA: Phosphoglucosamine mutase (glmM) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to mag:amb3199)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.10

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2C2 at UniProt or InterPro

Protein Sequence (451 amino acids)

>AMB_RS16165 phosphoglucosamine mutase (Magnetospirillum magneticum AMB-1)
MTRKLFGTDGIRGTANTDPMTAEMAMKLGMAAGRHFTRGDHRHVVVIGKDTRLSGYLLEP
ALTAGFISVGMDVVLLGPLPTPAVALLTRSMRADLGVMISASHNPYEDNGIKLFGPDGFK
LSDEDELTIEASMSNGLESCRVGSDHLGRAKRLDDAAGRYIEYAKYTFPRGLRLDGLKIV
VDCANGAAYKVAPTVLWELGAEVIPVAVNPDGFNINKNCGSLHTETMREQVVAHGAHLGI
ALDGDADRVVLCDELGHMIDGDQLMALIGDLWHRSGQLKGGGIVATVMSNLGLERFLDQR
GLKTIRTAVGDRYVLEHMRRDGFNVGGEQSGHIILSDHSTTGDGLVAGLQVLAALVQSGK
PASEMLRLFTPLPQVLKNVRVAKGSVAEVLAAPAVEAAIRDAEAKLAGQGRLLIRKSGTE
PLIRVMAEGEDEGLVEASVDAIVETIRRAAG