Protein Info for AMB_RS16100 in Magnetospirillum magneticum AMB-1

Annotation: RNA polymerase sigma factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR02392: alternative sigma factor RpoH" amino acids 14 to 284 (271 residues), 369 bits, see alignment E=1.7e-114 PF00140: Sigma70_r1_2" amino acids 16 to 46 (31 residues), 32.4 bits, see alignment 1.1e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 49 to 281 (233 residues), 106.3 bits, see alignment E=1.3e-34 PF04542: Sigma70_r2" amino acids 53 to 118 (66 residues), 65.8 bits, see alignment E=3.8e-22 PF04545: Sigma70_r4" amino acids 230 to 281 (52 residues), 59.9 bits, see alignment 2e-20

Best Hits

Swiss-Prot: 70% identical to RPOH_RHIRD: RNA polymerase sigma factor RpoH (rpoH) from Rhizobium radiobacter

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 100% identity to mag:amb3187)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2D4 at UniProt or InterPro

Protein Sequence (296 amino acids)

>AMB_RS16100 RNA polymerase sigma factor RpoH (Magnetospirillum magneticum AMB-1)
MTAIASSLSLAPEGNLTRYLQDIRKFPMLPPEEEYLLAKRFREHGDLPAANRLVTSHLRL
VAKIAMGYRGYGLPLGELISEGNVGMMQAVRRFDPERGFRLATYAMWWIRAAIQEYILHS
WSLVKMGTTAAQKKLFFNLRKLKGQMQAIEEGDMSAENVAKIATKLEVTEDEVVTMNRRL
SSPDHSLNAPVRAEGEGEWQDWLVDDHEDQETELGEREELGQRRQMLTSALEALNDRERA
ILIQRRLTEDPATLEDLSQRYGISRERVRQIEVRAFEKLQKSVKSASAQAEAQNRA