Protein Info for AMB_RS16025 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 13 to 31 (19 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 308 to 324 (17 residues), see Phobius details amino acids 330 to 347 (18 residues), see Phobius details amino acids 359 to 382 (24 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 383 (363 residues), 162.5 bits, see alignment E=6.9e-52 amino acids 248 to 429 (182 residues), 44.4 bits, see alignment E=5.5e-16

Best Hits

Swiss-Prot: 75% identical to TUB3_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: K13021, MFS transporter, ACS family, tartrate transporter (inferred from 100% identity to mag:amb3177)

Predicted SEED Role

"D-glucarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2E4 at UniProt or InterPro

Protein Sequence (437 amino acids)

>AMB_RS16025 MFS transporter (Magnetospirillum magneticum AMB-1)
MNTDMEKRVLRRISWRIVPFIMLLYFIAYIDRVNIGFASLTMNKDLGFTSSVFGFGAGIF
FFGYFLFEVPSNLILEKVGARLWITRVMITWGLISGAMAFVQGSTSFYVLRFLLGAAEAG
FFPGIILYLSYWFPARHRAGVTALFMAAAPISTALGSPISAALLELHGVMGLAGWQWMFI
IEALPALILGVVVFFYMTDRPEKATWMPEDERAWLINAMNEEAASKSGHAKHSIWRGLAD
PRVLALALIYFGTSAGLYTLGIWAPQIIKQLGVSSMTVGWLNMIPPTASVIAMVLWARHS
DRTSERTWHVVGACLVASAGLVFAGNADGVFTVILALTLVNIGISAAKPPLWSMPTMFLS
GSAAAAGIATINSIGNLGGFAGPAMIGWIKDLTGSFMGGLYFVAALLAISAVTTLLLARS
QRKSAAASAAAAQAASN