Protein Info for AMB_RS16015 in Magnetospirillum magneticum AMB-1

Annotation: glycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13660: DUF4147
  • amino acids 9 to 229 (221 residues), 304.9 bits, E=3.6e-95
• PF05161: MOFRL
  • amino acids 308 to 413 (106 residues), 124.3 bits, E=2.4e-40

Best Hits

KEGG orthology group: K00050, hydroxypyruvate reductase [EC: 1.1.1.81] (inferred from 100% identity to mag:amb3175)

Predicted SEED Role

"D-glycerate 2-kinase (EC 2.7.1.-)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism or Entner-Doudoroff Pathway (EC 2.7.1.-)

MetaCyc Pathways

• photorespiration I (7/9 steps found)
• L-serine biosynthesis II (3/4 steps found)
• photorespiration III (6/9 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.81, 2.7.1.-

Use Curated BLAST to search for 1.1.1.81 or 2.7.1.-

Sequence Analysis Tools

See Q2W2E6 at UniProt or InterPro

Protein Sequence (426 amino acids)

>AMB_RS16015 glycerate kinase (Magnetospirillum magneticum AMB-1)
MTQSHRDLLRRMFDAAVAAAQPAQCVPAYLPAVPKGRLIVIGAGKASAAMARAVEDNWAG
EVSGLVVTRYGYNVPCRRITIAEAAHPVPDAAGLNAARKMLDLVSDLTADDLVLCLISGG
GSALAPLPLDGLTLEDKQDVNRALLKSGATISEMNCVRRHLSAIKGGRLAAACHPARVVT
LLISDVPGDNPMNIASGPTVADPTTCTDAMAIIRRYGIVVSDKVLDVLESGRGESVKPGD
PRLALTETHVIAAPQVALEAAAKVAESAGFTAHILGDSIEGEAKDVGAVMAGIAHQVTKR
GQPFKPPCVLLSGGEATVTVRGQGRGGPNVEFLLALAVALNGQPGIHAIAGDTDGVDGME
DIAGAIITPNTLSRAWVMGIKPQDSLAANDAHRFFHALGDSVVTGPTLTNVNDFRAILIA
DKDSTP