Protein Info for AMB_RS15955 in Magnetospirillum magneticum AMB-1

Annotation: flagellar motor component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details PF01706: FliG_C" amino acids 287 to 373 (87 residues), 49 bits, see alignment E=3.4e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3165)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2F6 at UniProt or InterPro

Protein Sequence (405 amino acids)

>AMB_RS15955 flagellar motor component (Magnetospirillum magneticum AMB-1)
MTIFSSAIQSVRALRREAPTREAALALLLCLYDLWVLAKVKGDLYLEAHAEMPLSSSLFF
HHKPMRDLPWLLTPLVDFIRLMTLGSNNAKQARRLLQAYRETEKRALDHVLRQASLVWPM
GFCLWIAGLAVLASLGGLGLTALAWWGVSLAAAGVMVGIWLVRLRTIADHRLGVLDAMTE
GCLSYLNGYAQQICAENARFVLPPALKPSFFELADAFGEDSYFHRYGAYNGFTLSETGTQ
AEIDTKLAERLQAILDYDPDWLAKALPGLSRDITGELPADQVETVSAFSQLADLDEASLR
IILQSCAHDLRAAALIGTSSAVLERFVANLSEADQKTLVTDIRAMGSIPAADIAIAQRSV
LDLAKSLTDSGELAARTKEEGDLLTLWKRMSGEEGASGQPGRPEN