Protein Info for AMB_RS15810 in Magnetospirillum magneticum AMB-1

Annotation: trypsin-like serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF08238: Sel1" amino acids 83 to 117 (35 residues), 14.7 bits, see alignment 5.8e-06 amino acids 120 to 152 (33 residues), 19.5 bits, see alignment (E = 1.8e-07) amino acids 187 to 214 (28 residues), 15.7 bits, see alignment (E = 2.8e-06) PF00089: Trypsin" amino acids 352 to 496 (145 residues), 24.1 bits, see alignment E=4.5e-09 PF13365: Trypsin_2" amino acids 355 to 483 (129 residues), 83 bits, see alignment E=5.7e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3138)

Predicted SEED Role

"Probable serine protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2I3 at UniProt or InterPro

Protein Sequence (505 amino acids)

>AMB_RS15810 trypsin-like serine protease (Magnetospirillum magneticum AMB-1)
MTFLNRVKTLSGQGAIIFLVNPGAPQPGWSVKGEAMSSRWGKTMAMLIAMGGALPVQAAC
LARPSSTAELAQCSTAAAAGDSVAARMLGDVMGDPTQRHYDPATALSWWEQAAAAGDGLA
LRRLFDAHWYGRGTPKDLAKARTYLAKAVAGGAQWARLVRAVLAEGEEPGLAADLYNGLA
AEGNCLAQLRLAHGHDRGGWVEKNRSQALYWANVAGLAGRNEPPPEDHPLFENRFHYRDC
TSEAYFLRQELAHNLASDLRGRVEESAAAWKPGRMPERQGPVEAPPAIGVTPVGLGSGAA
AKLPDWRPLAASLQRPAGRSRLGAEDVFATVGRSVYVVIAARTEDELRAKKGRFGSAVAM
DERTVVTNCHVIDEMSVILLRQGGQTMRATPSGGDEATDRCLMTVSPGRLSAVPGIRAWE
DLRVGETVYSIGAPKGLEATLGQGLVSGLRTIKGLRYVQTTAPISQGSSGGGLFDSAGNL
VGITTFHIRDADGLNFAIAAEDFFR