Protein Info for AMB_RS15665 in Magnetospirillum magneticum AMB-1
Annotation: adenylate kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to KAD_MAGSA: Adenylate kinase (adk) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 100% identity to mag:amb3110)MetaCyc: 46% identical to adenylate kinase 1 (Saccharomyces cerevisiae)
Adenylate kinase. [EC: 2.7.4.3]; (Deoxy)adenylate kinase. [EC: 2.7.4.3, 2.7.4.11, 2.7.4.13]
Predicted SEED Role
"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
- superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
- pyrimidine deoxyribonucleotides biosynthesis from CTP (7/8 steps found)
- pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
- superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
- superpathway of purine nucleotide salvage (11/14 steps found)
- adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
- purine deoxyribonucleosides salvage (4/6 steps found)
- superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.4.11 or 2.7.4.13 or 2.7.4.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W2L1 at UniProt or InterPro
Protein Sequence (217 amino acids)
>AMB_RS15665 adenylate kinase (Magnetospirillum magneticum AMB-1) MNLVLLGPPGGGKGTQAKRLQDKYGLVQLSTGDMLRAAVASGSEVGKKAKAVMDAGQLVS DEIVIAIIDERLDQADVAKGAIFDGFPRTVAQAEALDAMMAKKGKKLDFAIEIRVPDAYI VERITGRYTCAKCGAGYHDKFQLPQVAGKCDSCGGTEFARRPDDNVDTVTKRLDAYHAQT APLLPYYDKKGSLKLVDGTMDIADVTKALEGILDASK