Protein Info for AMB_RS15660 in Magnetospirillum magneticum AMB-1

Annotation: 30S ribosomal protein S13

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 PF00416: Ribosomal_S13" amino acids 3 to 109 (107 residues), 105.4 bits, see alignment E=1.4e-34 TIGR03631: ribosomal protein uS13" amino acids 3 to 115 (113 residues), 175.4 bits, see alignment E=2.3e-56

Best Hits

Swiss-Prot: 85% identical to RS13_XANP2: 30S ribosomal protein S13 (rpsM) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02952, small subunit ribosomal protein S13 (inferred from 85% identity to xau:Xaut_4776)

MetaCyc: 59% identical to 30S ribosomal subunit protein S13 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S13p (S18e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>AMB_RS15660 30S ribosomal protein S13 (Magnetospirillum magneticum AMB-1)
MARIAGVNIPTNKRVLIALTYIHGIGRAKATEITTSLGIPVDRRVNQLTDDEVLKIRELI
DRDFQVEGDLRRSVAMNIKRLMDLGCYRGLRHRRGLPVHGQRTHTNARTRKGPAKPIAGK
KKVTK