Protein Info for AMB_RS15655 in Magnetospirillum magneticum AMB-1

Annotation: 30S ribosomal protein S11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 TIGR03632: ribosomal protein uS11" amino acids 12 to 128 (117 residues), 195.4 bits, see alignment E=1.5e-62 PF00411: Ribosomal_S11" amino acids 21 to 130 (110 residues), 168.3 bits, see alignment E=3.3e-54

Best Hits

Swiss-Prot: 100% identical to RS11_MAGSA: 30S ribosomal protein S11 (rpsK) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K02948, small subunit ribosomal protein S11 (inferred from 100% identity to mag:amb3109)

MetaCyc: 63% identical to 30S ribosomal subunit protein S11 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S11p (S14e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2L2 at UniProt or InterPro

Protein Sequence (131 amino acids)

>AMB_RS15655 30S ribosomal protein S11 (Magnetospirillum magneticum AMB-1)
MAKPAAAARPRRRERKNITSGVAHVNATFNNTMITITDAQGNTISWSSAGMQGFKGSRKS
TPYAAQVAAEDAGRKASEHGMRTLEVEVKGPGAGRESALRALQAVGFQITSIRDVTPIPH
NGCRPRKRRRV