Protein Info for AMB_RS15655 in Magnetospirillum magneticum AMB-1
Annotation: 30S ribosomal protein S11
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RS11_MAGSA: 30S ribosomal protein S11 (rpsK) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
KEGG orthology group: K02948, small subunit ribosomal protein S11 (inferred from 100% identity to mag:amb3109)MetaCyc: 63% identical to 30S ribosomal subunit protein S11 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S11p (S14e)" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W2L2 at UniProt or InterPro
Protein Sequence (131 amino acids)
>AMB_RS15655 30S ribosomal protein S11 (Magnetospirillum magneticum AMB-1) MAKPAAAARPRRRERKNITSGVAHVNATFNNTMITITDAQGNTISWSSAGMQGFKGSRKS TPYAAQVAAEDAGRKASEHGMRTLEVEVKGPGAGRESALRALQAVGFQITSIRDVTPIPH NGCRPRKRRRV