Protein Info for AMB_RS15640 in Magnetospirillum magneticum AMB-1

Annotation: methyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF13429: TPR_15" amino acids 28 to 186 (159 residues), 34.2 bits, see alignment E=1.6e-11 PF13432: TPR_16" amino acids 36 to 95 (60 residues), 25.9 bits, see alignment E=9.4e-09 amino acids 135 to 197 (63 residues), 33.6 bits, see alignment E=3.6e-11 PF14559: TPR_19" amino acids 39 to 95 (57 residues), 30.4 bits, see alignment E=3.4e-10 amino acids 142 to 192 (51 residues), 27.7 bits, see alignment 2.4e-09 PF07721: TPR_4" amino acids 131 to 153 (23 residues), 12.9 bits, see alignment (E = 0.00013) amino acids 166 to 186 (21 residues), 15.4 bits, see alignment (E = 2e-05) PF13489: Methyltransf_23" amino acids 224 to 371 (148 residues), 43.4 bits, see alignment E=2.7e-14 PF13847: Methyltransf_31" amino acids 242 to 337 (96 residues), 37.3 bits, see alignment E=1.9e-12 PF13649: Methyltransf_25" amino acids 243 to 332 (90 residues), 44 bits, see alignment E=2.5e-14 PF08241: Methyltransf_11" amino acids 244 to 336 (93 residues), 49.9 bits, see alignment E=3.6e-16 PF08242: Methyltransf_12" amino acids 244 to 334 (91 residues), 37.6 bits, see alignment E=2.7e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3106)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2L5 at UniProt or InterPro

Protein Sequence (394 amino acids)

>AMB_RS15640 methyltransferase domain-containing protein (Magnetospirillum magneticum AMB-1)
MGWLLFDDRRNLPVYIWFTMAAMGGLMTLTEAIQSALELVAQDDIDGALRAFDRIEASVP
GDATVLRLRAQTYLKVGQYAEAARILFGLVRADPKVDPIFDLVWALVHARAYVDIVGVCA
EYKHVIAGDKRFLAALGMAQTALGRYQDALATLSQAREVLPRDFYVRHNLSIALLHLGRH
EEAVEVFSELLPDWDGSAPDGVTLERLDAISVGYDDNELHNYFSDRLLRLYQGHFPARRM
RRVLEMGTGTGLLASKLPASTTSVTGIERSPGMLAQARARKVYDTLIEGEMPGGLASIEG
PFETILSSCVLYYFADLEPFFREASRLTEPGGVFVFSVDPLCDPREVAATVPGEYAHSRS
YLRRLATEAGFREVAMEIDRHRGPPGFWCAFKRG