Protein Info for AMB_RS15615 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 741 transmembrane" amino acids 190 to 210 (21 residues), see Phobius details amino acids 373 to 395 (23 residues), see Phobius details PF13426: PAS_9" amino acids 41 to 135 (95 residues), 44 bits, see alignment E=8.3e-15 PF00989: PAS" amino acids 46 to 134 (89 residues), 40.2 bits, see alignment E=1.1e-13 TIGR00229: PAS domain S-box protein" amino acids 46 to 136 (91 residues), 42.8 bits, see alignment E=2.8e-15 PF08447: PAS_3" amino acids 53 to 136 (84 residues), 58.5 bits, see alignment E=2.3e-19 PF12729: 4HB_MCP_1" amino acids 185 to 366 (182 residues), 62 bits, see alignment E=2e-20 PF02203: TarH" amino acids 185 to 357 (173 residues), 123.3 bits, see alignment E=3.7e-39 PF00015: MCPsignal" amino acids 558 to 706 (149 residues), 106.5 bits, see alignment E=5e-34

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to mag:amb3102)

Predicted SEED Role

"InterPro IPR000727:IPR003660:IPR004089 COGs COG0840"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2L9 at UniProt or InterPro

Protein Sequence (741 amino acids)

>AMB_RS15615 PAS domain-containing protein (Magnetospirillum magneticum AMB-1)
MPNGVILSDRPAGWSKQNRECPMRDNGAITNREVELKDDDMLVSRTDAGGRITFVNKAFI
DISGFTEQELLGSPHNLVRHPHMPKEAFADLWASIKAGRPWEGYVKNRTKTGDHYWVRAN
VTPFMEKGQIAGFISIRSKPTRAQINAAEQAYALFREGKARGLAIRDGRVVSTGLGGRVS
ALKNSIAGRLSGVLAVLGVLMLVVGWLGISGMRGIGEDMREVYLENTMPAIDLAEVADLS
QENYRQIASIAVQMLANQHWVPVSERLAAIESNSQIINRKWEHYAQGSHPAEELALIEKF
AKARTAFRDQGLIPAVDLVRKNDAAALSKHFGEAMRPLYNANHVALKGLIDYQSKDAGNT
YARAEQHLSSRTFLVIGALVVAVVLGFILAVWILAGIRNPLKAMERHFDAIASGNQAHEI
PVADMQEFGQLHSLLRALKAKLGYSALEKAELDRQAEENRRAELNRVAKSLEDRVKGVVD
LIDVSSGSLLGNAQTLSANAQQTMVQAGNVTAMTGQVTANVQSVSAATQELSSSVTEISR
QVAHAATISGDAVRQAGETDRMVRSLAEAAQKIGEVVNLITDIASQTNLLALNATIEAAR
AGEAGKGFAVVANEVKHLANQTAKATEEIGQQVTAIQGETRSAVEAIRSISGTIENISEL
SSAIAAAVEEQGAATAEIARSVEQAAHGTASAAENVEVVSGAAEETKLMSDQVYEAANGL
KGASNQLAQEVAGFIREIRSA