Protein Info for AMB_RS15585 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 PF12860: PAS_7" amino acids 24 to 137 (114 residues), 139.5 bits, see alignment E=1.9e-44 amino acids 178 to 291 (114 residues), 130.5 bits, see alignment E=1.2e-41 TIGR00229: PAS domain S-box protein" amino acids 298 to 414 (117 residues), 43.8 bits, see alignment E=1.3e-15 PF08448: PAS_4" amino acids 311 to 408 (98 residues), 37 bits, see alignment E=1.2e-12 PF13426: PAS_9" amino acids 312 to 405 (94 residues), 30.2 bits, see alignment E=1.6e-10 PF00512: HisKA" amino acids 428 to 493 (66 residues), 64.7 bits, see alignment E=2.3e-21 PF02518: HATPase_c" amino acids 542 to 652 (111 residues), 82.3 bits, see alignment E=1.2e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3096)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2M5 at UniProt or InterPro

Protein Sequence (657 amino acids)

>AMB_RS15585 PAS domain-containing sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MTGDSRKGAPSGQDIDMTVMQGVLDHLDQGISVFSADLRLILWNRRFTDLHDFPEGFLTH
GLGFADIIRFNAQRGEYGSDCDVEATVRHRVDAAMEFQAHRFERTRPNGTILEIIGNPLP
GGGFVTTYSDVTVNRQVAENLRDSNDRLDQMVERRTQALQDSEERHRAYGEFLEATVKHM
PQGVCLFDNDLNLVVANKIFFDLTQIPASFNVKGINFHEFMLYNAQRGEYGPGDPAELAN
RRLEIARRMEPHAFDRIRPDGTVIEVRGNPIPGRGFISTFTDITARAKAEESLREAATMA
RAMLDAPGLLVLLIRMDGTIVDLNQEAATGLSSTKDAMIGANIFTVMPPKVAERRFAYAQ
QAVFEGHAVYFEDERDGRWFETTMTPYPMDQDGVHRVMIIAHDVTHRHHAEQRLREATAM
AQAANRTKTDFLAAMSHELRTPLNAILGFSEIIAREMFGPVGDRYRIYGQDINSAGQHLL
AMINDILDISRIEIGAFTLCVEQVNPHELVDSCLRLVTTRAEAAGIRLREDLPETLPSLM
IDSRRTKQILINLLGNAVKFTPAGGSVTLRGALQSDGGMAFHVADTGIGMSEADIAIALS
PFGQVDTGLDRRFEGAGLGLPLAKSLAELHGGSLEIISTPGEGTTVSVYFPAACVAR