Protein Info for AMB_RS15580 in Magnetospirillum magneticum AMB-1

Annotation: cyclic nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 870 PF23023: Anti-Pycsar_Apyc1" amino acids 234 to 361 (128 residues), 42.2 bits, see alignment E=2.1e-14 PF00753: Lactamase_B" amino acids 251 to 299 (49 residues), 32.2 bits, see alignment 2.6e-11 PF12706: Lactamase_B_2" amino acids 255 to 385 (131 residues), 35.8 bits, see alignment E=1.6e-12 PF00027: cNMP_binding" amino acids 512 to 595 (84 residues), 45.1 bits, see alignment E=2e-15 TIGR02481: hemerythrin-like metal-binding domain" amino acids 742 to 864 (123 residues), 119.8 bits, see alignment E=3.8e-39 PF01814: Hemerythrin" amino acids 750 to 863 (114 residues), 57 bits, see alignment E=7.1e-19

Best Hits

KEGG orthology group: K07216, hemerythrin (inferred from 100% identity to mag:amb3095)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2M6 at UniProt or InterPro

Protein Sequence (870 amino acids)

>AMB_RS15580 cyclic nucleotide-binding protein (Magnetospirillum magneticum AMB-1)
MAGLFKVDVAAGMAWVEIPERDLRVLCGCPADAVKHMMLRGLIRPTRRDGIPCETGPSAI
LLSDVMIQNGAFCNLAEFPVLQMFYRQGMLLPGHPNNTGRRPLLIGRNEQLQAQFQYIYR
GNYGLISTEELMEAGLDEATARDMMRLKLRFAFGRIQHPRELLDTRPLADEPIEIAEGVT
LRRTALNVFEFSHGDERVSVDLNLPPFEIHECPYTLGFHQIPREYFAVIHSGDGDGWDIR
RPSMGAILVFQGRIYLIDAGPNLIYSLNALGIGINEIEGIFHTHSHDDHFAGLTTLIRAD
RRIKYHATPMVRAAVTKKLAALLSIEEEDFSDYFDVCDLTLGEWNDVGGLEVRPIFSPHP
VETTPFYFRVMAEGGYRTYAHMADISGLDVLQGMITEDPAKPGLSLAWMERIVTDYFEPA
DVKKVDIGGGLIHGMAGDFAEDQSRKIILSHTALKLTDEQKRIGSGASFGTVDVLVRSYR
DFARRSAYEHLASYFPEIGDAHLQVLLNCPLESFNPETILIREGAIGDAIYLVLTGQVEM
LSSDSQVRSLLSAGALLGELAGLHGLPSMETYRATSYVQALRLSADFYLEFVKRHDLFAD
ISRLMEIREFLSRTWLFGEVVSTGTLNRIANHMRPLAVHAGEALSVGESNVALIRLGDAI
RLLGEQELERLGPGDFFGEETAMFQTPRLSRIISSETMELYVVPAQTLADIPGVRWKLFE
TFHRRTRACAEAQVVSSTDLVWRDEYSVNIQRIDNHHRRLFEMSNRLIEAVRLSKGKAEI
GEALDFLMGYAMYHFSEEEALLERYGYPEGAGHASRHRRLMAQARELEEHLASAAISADE
VLTFLQDWIVNHILMEDRRYAPFINSKGVY