Protein Info for AMB_RS15515 in Magnetospirillum magneticum AMB-1

Annotation: nitrous oxide reductase family maturation protein NosD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR04247: nitrous oxide reductase family maturation protein NosD" amino acids 45 to 422 (378 residues), 358.7 bits, see alignment E=2.8e-111 PF13229: Beta_helix" amino acids 95 to 251 (157 residues), 52.5 bits, see alignment E=6.6e-18 amino acids 197 to 342 (146 residues), 49.3 bits, see alignment E=6.3e-17 PF05048: NosD" amino acids 156 to 358 (203 residues), 129.8 bits, see alignment E=1.5e-41

Best Hits

KEGG orthology group: K07218, nitrous oxidase accessory protein (inferred from 100% identity to mag:amb3081)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosD" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2P0 at UniProt or InterPro

Protein Sequence (481 amino acids)

>AMB_RS15515 nitrous oxide reductase family maturation protein NosD (Magnetospirillum magneticum AMB-1)
MGVLIKTFSKSRLGAMAFVFAASLSTAGATPEGQDNEPLLDSSLIQALIDIAQPGQVISP
PPGRYKSHLVVSKPIIFDGKNQVTLDGEGRGSVLWIKTDGATVRNFRITNTGPDHSKQDA
GVQVRGKDNVVEDLRMDNVLFGFSLEQSERNTVRRNRVEGKKVSLGRRGDGIKLWYSHHN
VIEDNQFIQGRDIVFWYSTHNRFAGNRQSGGRYGLHLMQAQYNIAEGNYFFDNSTGISMM
YDTGDELRNNVIAKAVGAQGVCISLKESSDVVIENNDILYCSQGISIDVAPYEPDSKNHL
RGNRIAYNDIGVAFLNDWKDNEFTGNLFSGNITEVAVYGGGSAKRNVWDGNRWEDYQGFD
RDGDGVGDKPHRLFNYAGRVWMDKPNTRFFKGTPLLEVLDFLDRLAPFSEPVLMLEDKHP
LVASDARVKAGSSLDATEDLNRNIDRPRRAGEVPVAHEKAGAGRGGSLEPRRGTFGSKDD
D