Protein Info for AMB_RS15510 in Magnetospirillum magneticum AMB-1

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details PF12800: Fer4_4" amino acids 67 to 80 (14 residues), 17.4 bits, see alignment (E = 2.2e-06) amino acids 225 to 238 (14 residues), 14.8 bits, see alignment (E = 1.6e-05) PF12838: Fer4_7" amino acids 67 to 123 (57 residues), 33.8 bits, see alignment E=1.9e-11 amino acids 191 to 238 (48 residues), 28.5 bits, see alignment 8.6e-10 PF00037: Fer4" amino acids 67 to 84 (18 residues), 27.2 bits, see alignment (E = 1.2e-09)

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3080)

Predicted SEED Role

"Ferredoxin-type protein NapG (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2P1 at UniProt or InterPro

Protein Sequence (254 amino acids)

>AMB_RS15510 4Fe-4S dicluster domain-containing protein (Magnetospirillum magneticum AMB-1)
MTEHDAPPKVAPTPHPNNKTRRMVMRSIAMGGAVVGASLFGFFPVLRKWTPRLRPPGAID
EADFLAACIKCGQCVQVCPVKAIELGDLDEGFGVGVPYVPARAQACDFSCDAVQCVLACP
TGALSHKISKKEEVRMGLARLDRPNACLARKGEGFKGVARPAPFKGVHRYPEIDRWKPVK
LAEYKYDLAVCDLCVRECPVQGAITLEPMSADPADKRRTPVVHQPCVGCGMCEMICPTEP
ASIVVDIRRKWGDA