Protein Info for AMB_RS15485 in Magnetospirillum magneticum AMB-1
Annotation: bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to UBIE_RUBGI: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Rubrivivax gelatinosus (strain NBRC 100245 / IL144)
KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 51% identity to afr:AFE_0289)MetaCyc: 48% identical to bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinol methylase and demethylmenaquinone methyltransferase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]; ADOMET-DMK-METHYLTRANSFER-RXN [EC: 2.1.1.201, 2.1.1.163]
Predicted SEED Role
No annotation
MetaCyc Pathways
- menaquinol-10 biosynthesis (2/2 steps found)
- menaquinol-11 biosynthesis (2/2 steps found)
- menaquinol-12 biosynthesis (2/2 steps found)
- menaquinol-13 biosynthesis (2/2 steps found)
- menaquinol-7 biosynthesis (2/2 steps found)
- menaquinol-4 biosynthesis I (1/1 steps found)
- menaquinol-6 biosynthesis (1/1 steps found)
- menaquinol-8 biosynthesis (1/1 steps found)
- menaquinol-9 biosynthesis (1/1 steps found)
- superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (8/12 steps found)
- ubiquinol-8 biosynthesis (early decarboxylation) (5/8 steps found)
- ubiquinol-9 biosynthesis (early decarboxylation) (5/8 steps found)
- ubiquinol-10 biosynthesis (early decarboxylation) (4/8 steps found)
- ubiquinol-9 biosynthesis (late decarboxylation) (4/8 steps found)
- ubiquinol-10 biosynthesis (late decarboxylation) (4/9 steps found)
- ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
- ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
- ubiquinol-8 biosynthesis (late decarboxylation) (3/9 steps found)
- ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
- ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
- superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
- superpathway of menaquinol-10 biosynthesis (3/10 steps found)
- superpathway of menaquinol-8 biosynthesis I (3/10 steps found)
- superpathway of chorismate metabolism (38/59 steps found)
- superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
- superpathway of menaquinol-11 biosynthesis (2/10 steps found)
- superpathway of menaquinol-12 biosynthesis (2/10 steps found)
- superpathway of menaquinol-13 biosynthesis (2/10 steps found)
- superpathway of menaquinol-6 biosynthesis (2/10 steps found)
- superpathway of menaquinol-7 biosynthesis (2/10 steps found)
- superpathway of menaquinol-8 biosynthesis II (2/10 steps found)
- superpathway of menaquinol-9 biosynthesis (2/10 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.163
Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (243 amino acids)
>AMB_RS15485 bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE (Magnetospirillum magneticum AMB-1) MTTSLSGTFGFQSVTPEERETRIRAVFNAVAPRYDLMNDVMSFGIHRLWKREMVKAARPE AGQVMVDLAGGTGDVARLLAGQGRRVMVCDPSPEMMAVGQRRCRGLGVEFIEGKAEAMPF ETNSVDTLTIAFGLRNATSPDAALAEIFRVLKPGGWFVCLEFSKPWALIRPFYDAYSFHV IPRLGAWIAREPAAYAYLVESIRRFPDQREMAGLMADAGFQRVVWRNLSAGIACLHSGVK PAS