Protein Info for AMB_RS15485 in Magnetospirillum magneticum AMB-1

Annotation: bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF01209: Ubie_methyltran" amino acids 19 to 240 (222 residues), 243.2 bits, see alignment E=7.2e-76 TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase" amino acids 23 to 240 (218 residues), 261.3 bits, see alignment E=2.9e-82 PF13489: Methyltransf_23" amino acids 48 to 221 (174 residues), 41.1 bits, see alignment E=4.9e-14 PF13847: Methyltransf_31" amino acids 61 to 163 (103 residues), 45 bits, see alignment E=2.7e-15 PF08242: Methyltransf_12" amino acids 66 to 157 (92 residues), 38.8 bits, see alignment E=3.9e-13 PF13649: Methyltransf_25" amino acids 66 to 155 (90 residues), 70.5 bits, see alignment E=4.9e-23 PF08241: Methyltransf_11" amino acids 66 to 159 (94 residues), 75.2 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 64% identical to UBIE_RUBGI: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Rubrivivax gelatinosus (strain NBRC 100245 / IL144)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 51% identity to afr:AFE_0289)

MetaCyc: 48% identical to bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinol methylase and demethylmenaquinone methyltransferase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]; ADOMET-DMK-METHYLTRANSFER-RXN [EC: 2.1.1.201, 2.1.1.163]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.163

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>AMB_RS15485 bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE (Magnetospirillum magneticum AMB-1)
MTTSLSGTFGFQSVTPEERETRIRAVFNAVAPRYDLMNDVMSFGIHRLWKREMVKAARPE
AGQVMVDLAGGTGDVARLLAGQGRRVMVCDPSPEMMAVGQRRCRGLGVEFIEGKAEAMPF
ETNSVDTLTIAFGLRNATSPDAALAEIFRVLKPGGWFVCLEFSKPWALIRPFYDAYSFHV
IPRLGAWIAREPAAYAYLVESIRRFPDQREMAGLMADAGFQRVVWRNLSAGIACLHSGVK
PAS