Protein Info for AMB_RS15470 in Magnetospirillum magneticum AMB-1
Annotation: oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 61% identical to ACUI_RUEPO: Acrylyl-CoA reductase AcuI (acuI) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
KEGG orthology group: None (inferred from 100% identity to mag:amb3072)MetaCyc: 61% identical to acryloyl-CoA reductase monomer (Ruegeria pomeroyi DSS-3)
RXN-9087 [EC: 1.3.1.84]
Predicted SEED Role
"YhdH, a putative quinone oxidoreductase"
MetaCyc Pathways
- superpathway of the 3-hydroxypropanoate cycle (13/18 steps found)
- acrylate degradation II (2/3 steps found)
- 3-hydroxypropanoate cycle (9/13 steps found)
- glyoxylate assimilation (9/13 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.3.1.84
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W2P9 at UniProt or InterPro
Protein Sequence (331 amino acids)
>AMB_RS15470 oxidoreductase (Magnetospirillum magneticum AMB-1) MSDFPALMLDETDGKVTASIRRLTDSDLPEGEVLVKVEYSTLNYKDGMILGGLGRLVRKY PHVPGVDFAGTVEASASPEFKPGDRVILTGWRVGETHWGGYAAKARVKADWLVPLPQGLS ARQAMAVGTAGFTAMLAVMALEDHGLRTSDEGEVLVTGAAGGLGSVAVLLLSKLGYRVAA STGRESLGEYLRSLGASSIVDRAEVGAPPAKPLLSERWAAAVDSVGGATLANTVASLRVR GAVASCGNAGGVEFNLTVLPFLLRGACILGIDSVMAPKPRRLIAWKRLAELLPLDRLDSL TTEIRLVDLPEMGAKILKGEVKGRVVVDPNR