Protein Info for AMB_RS15405 in Magnetospirillum magneticum AMB-1

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 transmembrane" amino acids 390 to 409 (20 residues), see Phobius details PF13181: TPR_8" amino acids 60 to 91 (32 residues), 12.3 bits, see alignment (E = 0.0001) amino acids 165 to 197 (33 residues), 12 bits, see alignment (E = 0.00013) amino acids 234 to 265 (32 residues), 27.2 bits, see alignment (E = 1.7e-09) PF13432: TPR_16" amino acids 139 to 191 (53 residues), 16.1 bits, see alignment 7.9e-06 amino acids 205 to 267 (63 residues), 27.6 bits, see alignment E=1.9e-09 amino acids 239 to 285 (47 residues), 22.7 bits, see alignment 6.6e-08 PF00515: TPR_1" amino acids 234 to 265 (32 residues), 35.1 bits, see alignment (E = 4.8e-12) PF07719: TPR_2" amino acids 234 to 265 (32 residues), 31.7 bits, see alignment (E = 5.8e-11) PF13176: TPR_7" amino acids 235 to 265 (31 residues), 19.7 bits, see alignment (E = 4.1e-07) PF13374: TPR_10" amino acids 237 to 262 (26 residues), 19.9 bits, see alignment (E = 3.6e-07) PF13414: TPR_11" amino acids 240 to 275 (36 residues), 32.7 bits, see alignment 2.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3060)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2R1 at UniProt or InterPro

Protein Sequence (581 amino acids)

>AMB_RS15405 tetratricopeptide repeat protein (Magnetospirillum magneticum AMB-1)
MGGMSGMDVEDERFLTRLAERLPGDAEVLARLAVMRVRLGGLDGAKACAERAVELAPGLA
EAHAALGLVQGRLRRFSEARLSLEHAVRINPRLGMAWLHLGEVLSTFPDQLQAAAEALRR
AGGLMPRDHRPLNALAGVLMGGKRYDDAVQAYRAAAAMATDPNLADMLNNMGVALERLER
RDEAVPMMRAASLIRPDSPAIHDNLGNALLGTAQAEEAETCHRRALALGAKGGETWSNLG
NSLHRQGRLDEADAAYRRAIEINPEEPKFHTNLALNLLLAGRMEEGWREYEWRWRGHPNL
PPYLVDRVWTGEPLPADLPGGGTLLLQAEQGYGDTLQFIRYVPQLKARGVNRVILACQPE
LIRLMETAPGLDAVVGEAGPMPPFDKAVTLLSLPGLLGGLAAPAAFPYLSVPQGVRMPLP
AAPAGTLKVGLAWAGRPTHGDDWNRSIPARMLAPILDVPGVTFYSLQRGAVAPRLGRPPA
DRLVEAADLCADFCDTAAMLMGLDLIISVDTAVVHLAGALGKPVWLLLPSVPDFRWRLEG
EASDWYPAFRLFRRKGQSGWEAPIARLAEALRARVDRPASA