Protein Info for AMB_RS15400 in Magnetospirillum magneticum AMB-1

Annotation: GntR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00392: GntR" amino acids 32 to 89 (58 residues), 49.6 bits, see alignment E=2.5e-17 PF07729: FCD" amino acids 102 to 218 (117 residues), 38.7 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3059)

Predicted SEED Role

"transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2R2 at UniProt or InterPro

Protein Sequence (236 amino acids)

>AMB_RS15400 GntR family transcriptional regulator (Magnetospirillum magneticum AMB-1)
MLRDFGVRIGLSTIGMSRVRRPKDPTELSAAEWVRQQLIDDIVAGRLRPGEKLCEVKIAA
RLGCSRTPVREAFRHLGALGLANFEKNRGGNVVRLERAQMLELFEALAEVAASCAGLAAS
RGEARRRILEEQGRLDHIAVPAGTGGEGDLFTTVFDICGNQLLAASGSAIRCRLLPYWRL
LGSTADDWASHGGLGQAAAIRAIAAGDGRAARRAMRTFVLMARDHAVRGVPPSALP