Protein Info for AMB_RS15380 in Magnetospirillum magneticum AMB-1

Annotation: serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13432: TPR_16" amino acids 35 to 93 (59 residues), 16.3 bits, see alignment 4.5e-06 amino acids 104 to 153 (50 residues), 17.6 bits, see alignment 1.7e-06 amino acids 173 to 231 (59 residues), 20.1 bits, see alignment 2.8e-07 PF13181: TPR_8" amino acids 71 to 93 (23 residues), 15 bits, see alignment (E = 8.8e-06) PF13428: TPR_14" amino acids 103 to 143 (41 residues), 23.6 bits, see alignment 2.3e-08 PF14559: TPR_19" amino acids 111 to 176 (66 residues), 31.2 bits, see alignment E=9.1e-11 PF13365: Trypsin_2" amino acids 322 to 459 (138 residues), 85.5 bits, see alignment E=2.5e-27 PF00089: Trypsin" amino acids 326 to 467 (142 residues), 41.6 bits, see alignment E=5.3e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3055)

Predicted SEED Role

"Serine protease precursor MucD/AlgY associated with sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2R6 at UniProt or InterPro

Protein Sequence (526 amino acids)

>AMB_RS15380 serine protease (Magnetospirillum magneticum AMB-1)
MRGLRIIAWILFLGFPTVAPTCAQAAPAAGAQAMDQAMALIDAEQYQAAIAVLRGLDPQS
AAQAAEIDRALGRIYLGLGKAGKAAEFFEQALTTSLESEAESTLGLAEAKMALGHLAQAR
RHAESVLKTDPDQLQAHLVLARIDQRLGRAADATLRLENLSRQRPDSEEVAVMLARYQAR
AFSPATAAERLGQFLRRHPDSAEASDVLGLLLWEMGRKAEALKARDRAAELFRQRGRDGR
AAAILQWRQNVAPEARPAEASPPTPAPEPPPPAVAPIPEVKSLQPPPPPPPPAPPPSRPR
SFQALANPEPLPFKPGTPVLFGSGIVLEGGRQVITNRHVVDGARDTAIRNGTGHVRRARV
IKVSAEDDLALLELSEPFPEGDAMPISAISDGAPGRAAIVMGFPLITVLGDEQPALAEGI
VSKMGGLNGDPASFQMTTKLNQGNSGGPVFDRSGRLIGIAVAKLDTADLKSRSGISAEDV
NFAIKSSRLLRFLGRKGGGKAAAGDMSLEDLYQSMLPRVVLIASPK