Protein Info for AMB_RS15375 in Magnetospirillum magneticum AMB-1

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 signal peptide" amino acids 1 to 52 (52 residues), see Phobius details transmembrane" amino acids 197 to 219 (23 residues), see Phobius details PF17201: Cache_3-Cache_2" amino acids 50 to 198 (149 residues), 107.5 bits, see alignment E=2.1e-34 PF17203: sCache_3_2" amino acids 52 to 188 (137 residues), 59.6 bits, see alignment E=9.5e-20 PF17202: sCache_3_3" amino acids 90 to 190 (101 residues), 123.3 bits, see alignment E=1.4e-39 PF00672: HAMP" amino acids 221 to 268 (48 residues), 31.5 bits, see alignment 4.6e-11 PF00015: MCPsignal" amino acids 379 to 533 (155 residues), 104.2 bits, see alignment E=1.9e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3054)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2R7 at UniProt or InterPro

Protein Sequence (570 amino acids)

>AMB_RS15375 methyl-accepting chemotaxis protein (Magnetospirillum magneticum AMB-1)
MQTTKRGIAMLGHRIATMGIVPKIMALAVSGVLLLGLSVTLLSRSLLHASAADAARERVE
TNMKVAWDVLKSKGTAFSVADGKILAGDHVLNGNFDVVDKIKALVGGSATVFMGDTRVTT
NVIKPDGSRAVGTQLAKTAAYEAVFGRKTSFRGEVEILGEPYMTAYDPILDGAGNVIGVL
YVGIKKADFLVAAERTLQLMVGVTVLVGALSILVSWTIAKRNLATPLKRSILAMRDLADG
NLDVAIRHTERRDEIGEMIRALEIFKENGQARHRLEAAQAAEQAARNRRQEAIERLTTDF
NSSVFAVLNGVTESAHHLRDSAQSMTSVAEDTSRQSTVVAAAAEQASVNVETVAAAAEQL
AASEHEIARQVANSSEISHRASEEAERVNSIVLSLSEATNRIGQVVTLINDIAAQTNLLA
LNATIEAARAGDAGKGFAVVANEVKHLATQTARATEDIVVQINSVQAVTRDAVSAIGGIG
HTISSISESASAIASAVEEQTAATAEIARNVQEASSGTREVTSSITLVNQGAATTGSAAH
QLLGTADELSQQSEQLATEVSEFLAAIKAA