Protein Info for AMB_RS15355 in Magnetospirillum magneticum AMB-1

Annotation: chromosome partitioning ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 314 to 336 (23 residues), see Phobius details PF10609: ParA" amino acids 6 to 44 (39 residues), 33.7 bits, see alignment 9.3e-12 PF13614: AAA_31" amino acids 6 to 179 (174 residues), 150.9 bits, see alignment E=1.3e-47 PF09140: MipZ" amino acids 6 to 48 (43 residues), 33.5 bits, see alignment 1e-11 PF02374: ArsA_ATPase" amino acids 8 to 49 (42 residues), 27.8 bits, see alignment 5.1e-10 PF01656: CbiA" amino acids 8 to 230 (223 residues), 71.5 bits, see alignment E=2.3e-23 PF00142: Fer4_NifH" amino acids 10 to 59 (50 residues), 28.7 bits, see alignment 3.4e-10 PF06564: CBP_BcsQ" amino acids 10 to 248 (239 residues), 23.8 bits, see alignment E=1.1e-08

Best Hits

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 100% identity to mag:amb3050)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2S1 at UniProt or InterPro

Protein Sequence (341 amino acids)

>AMB_RS15355 chromosome partitioning ATPase (Magnetospirillum magneticum AMB-1)
MGAKPRIVVVFNQKGGIGKTTTSVNLAVCLAELGRKVVLVDLDAQSNASTSVGLTSPAAT
GAYQLLRGEVDVSHASRATPYPNLRLVAGSDDLSWADVEIAVKLDPQYVLERALETTPAD
VDVVVVDCPPAFGILSVNAAVAADVVILPVVPAPLALDGLHKAWWNIQRVRTHFNRDLES
MGILFTMTEDSDVMHRISDSVVASFGGRVLPVRVPRDLKVVEAAARDLPLVILDPESPAA
KAYGLLADFVDAHMLEPRAVAPGIAPGPVVEEEEELPPLRQSPPMEPGPAPGANWDEQLA
ETVDMVPEVSDLRWKIGVAIMLILLGGCVGYAFGRWMYMPL