Protein Info for AMB_RS15350 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF00989: PAS" amino acids 87 to 201 (115 residues), 23.4 bits, see alignment E=1.3e-08 TIGR00229: PAS domain S-box protein" amino acids 89 to 211 (123 residues), 48 bits, see alignment E=6.5e-17 PF08448: PAS_4" amino acids 98 to 206 (109 residues), 49.6 bits, see alignment E=1.1e-16 PF13426: PAS_9" amino acids 101 to 203 (103 residues), 29 bits, see alignment E=2.7e-10 PF00512: HisKA" amino acids 224 to 293 (70 residues), 65.4 bits, see alignment E=9.5e-22 PF02518: HATPase_c" amino acids 340 to 450 (111 residues), 103 bits, see alignment E=3.3e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3048)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2S3 at UniProt or InterPro

Protein Sequence (454 amino acids)

>AMB_RS15350 PAS domain-containing sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MSHATHSTFANSPRALAVLGPDGLLAHVGETLSRALGTAEPRLIGTRPGWVDGPDCTHTP
LPGGQTLVELAPEAETRLRDSLRVNVEMRAIIENTFEFIGLLSPDGRLLDANRTALAFIG
LDSLAPVLGMHFAETPWWEHSPEERAILRDGISRAAKGEFVRFETTHVDADGGIAYVDFS
VKPVPDHEGNILFLVPEGRDITQRKRAEAALVAAKQEAEAANRAKSQFLATVSHELRTPL
NAVIGFSEAILAGATGPASLERCVEYMDLIHSAGQHLRALIEDILDVSRIEAGRTELDEE
EADPAELVRAAARLLEHKAVVTGVDFTVVIAPDLPRMRLDPRRIRQVLLNLAGNALKFTP
AGGRVGISAEHVPEGLALTVEDTGIGIAPEHHAKVWQAFYQADSSLSRRHQGSGLGLAIV
RHFVEAHGGTVSLASEAGKGTRITVLLPASRIIT