Protein Info for AMB_RS15345 in Magnetospirillum magneticum AMB-1

Annotation: 30S ribosomal protein S12 methylthiotransferase RimO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR01125: ribosomal protein S12 methylthiotransferase RimO" amino acids 7 to 435 (429 residues), 549.2 bits, see alignment E=7.7e-169 PF00919: UPF0004" amino acids 7 to 93 (87 residues), 66.9 bits, see alignment E=2e-22 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 7 to 435 (429 residues), 332.1 bits, see alignment E=4.8e-103 PF04055: Radical_SAM" amino acids 142 to 319 (178 residues), 80.9 bits, see alignment E=1.9e-26 PF18693: TRAM_2" amino acids 377 to 438 (62 residues), 68.2 bits, see alignment E=8e-23

Best Hits

Swiss-Prot: 100% identical to RIMO_MAGSA: Ribosomal protein S12 methylthiotransferase RimO (rimO) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K14441, ribosomal protein S12 methylthiotransferase [EC: 2.-.-.-] (inferred from 100% identity to mag:amb3047)

MetaCyc: 67% identical to ribosomal protein S12 methylthiotransferase RimO (Escherichia coli K-12 substr. MG1655)
RXN0-6366 [EC: 2.8.4.4]

Predicted SEED Role

"Ribosomal protein S12p Asp88 (E. coli) methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2S4 at UniProt or InterPro

Protein Sequence (448 amino acids)

>AMB_RS15345 30S ribosomal protein S12 methylthiotransferase RimO (Magnetospirillum magneticum AMB-1)
MSQTNPKVGIVSLGCSKALVDSERILTKLRAEGYDISGSYDGADVVIVNTCGFLDSARAE
SLEAIGEALAENGKVIVTGCMGGDEKAIRSAHPSVLAVSGPHQYQAVVEAVHAAIPPLHD
PKLSLVPPEGLHLTPHHYAYLKISEGCNNSCSFCIIPDIRGPLMSRPAADVLGEAERLAE
AGVRELLVISQDTSAYGLDLRHAESTWRGRPVRAHLTDLASALGELGIWIRLHYVYPYPH
VDEIIPLMAEGKILPYLDIPFQHASPNVLKAMRRPANQEKVLGRIRSWRETCPDLTLRST
FIVGFPGETEEDFDSLLGWLEEAQLDRVGCFKYEDVKGAPANAFADQVDEDVKEERHQRF
MEAARQIADERGAAKEGTRIEVIIDEVDEEGAIGRSKADSPEVDGAVFMNGETDLEPGDL
VIVEVEAAEDYDLWGDVVERLPPPRPRR