Protein Info for AMB_RS15340 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 28 to 53 (26 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details

Best Hits

Swiss-Prot: 39% identical to TUPB_CAMJE: Tungstate uptake system permease protein TupB (tupB) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: K05773, putative tungstate transport system permease protein (inferred from 100% identity to mag:amb3046)

Predicted SEED Role

"ABC-type tungstate transport system, permease protein" in subsystem ABC transporter tungstate (TC 3.A.1.6.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2S5 at UniProt or InterPro

Protein Sequence (234 amino acids)

>AMB_RS15340 ABC transporter permease (Magnetospirillum magneticum AMB-1)
MSDLSQALSLALDLVVTLDPQMLGIVRLSVLVSGMAVLLAALIGLPLGAVLALSSFPGRG
ALVVMLNAFMGLPPVVVGLGVYLLLSRAGPLGEAGLLFTPSAMVAAQTLLVLPIVAALSR
QVVADLWEEYGEQLRSLGVSPGGRMLTLLWDGRFSLLTAVLAGFGRAAAEVGAVMIVGGN
IKGVTRTMTTTIALETSKGDLPLALGLGLILIALVTMVNAAVFLVGQWARRRMG