Protein Info for AMB_RS15275 in Magnetospirillum magneticum AMB-1

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 97 to 115 (19 residues), see Phobius details PF02129: Peptidase_S15" amino acids 25 to 140 (116 residues), 38.9 bits, see alignment E=2.5e-13 PF00561: Abhydrolase_1" amino acids 37 to 139 (103 residues), 28.8 bits, see alignment E=2.9e-10 PF12146: Hydrolase_4" amino acids 37 to 134 (98 residues), 34.9 bits, see alignment E=3.2e-12 PF01738: DLH" amino acids 83 to 196 (114 residues), 22.2 bits, see alignment E=2.8e-08 PF00326: Peptidase_S9" amino acids 148 to 195 (48 residues), 23.4 bits, see alignment 1.2e-08

Best Hits

Swiss-Prot: 57% identical to Y471_RICPR: Uncharacterized protein RP471 (RP471) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K07018, (no description) (inferred from 100% identity to mag:amb3032)

Predicted SEED Role

"Alpha/beta hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2T9 at UniProt or InterPro

Protein Sequence (231 amino acids)

>AMB_RS15275 alpha/beta hydrolase (Magnetospirillum magneticum AMB-1)
MPEVIFNGPDGRLEGRYHHGKSPNAPLALLLHPHPQHGGTMNNKVVYALYHAFVRRGFST
LRFNFRGVGRSQGKFDNGQGELSDAASALDWMQSFNANASACWVGGFSFGAWIGMQLLMR
RPEIDGFVSVAPPANVFDFSFLAPCPSSGLIVHGTNDDLVPEPTVAKLAAKLATQRNIKV
RYETIEGANHFFGTHLDALDGMVDSYLAESIVARAPAPPPVAEPELAVALS