Protein Info for AMB_RS15265 in Magnetospirillum magneticum AMB-1

Annotation: Rrf2 family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00738: Rrf2 family protein" amino acids 1 to 133 (133 residues), 140 bits, see alignment E=2.1e-45 PF02082: Rrf2" amino acids 3 to 134 (132 residues), 134.4 bits, see alignment E=1.5e-43

Best Hits

Swiss-Prot: 56% identical to YOR2_AZOVI: Putative HTH-type transcriptional regulator ORF2 from Azotobacter vinelandii

KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 100% identity to mag:amb3030)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2U1 at UniProt or InterPro

Protein Sequence (157 amino acids)

>AMB_RS15265 Rrf2 family transcriptional regulator (Magnetospirillum magneticum AMB-1)
MKLSTKGRYAVMAMVDLASHSEGSPVALADIAERQEISLSYLEQLFGKLRKGGLVKSVRG
PGGGYLLSRIPQQTRISDIILAVDEPIQTTRCSPGSPAGCHNNKGRCLTHDLWEELGNQI
YLYLSSVSLADVCERRILGSSGMFHGTAAPSGAVAAQ