Protein Info for AMB_RS15195 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome c-type protein nrfB precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR03508: decaheme c-type cytochrome, DmsE family" amino acids 39 to 312 (274 residues), 315.1 bits, see alignment E=3.6e-98 PF14537: Cytochrom_c3_2" amino acids 135 to 219 (85 residues), 28.6 bits, see alignment E=2.5e-10 TIGR01905: doubled CXXCH domain" amino acids 141 to 172 (32 residues), 28.6 bits, see alignment 1e-10 amino acids 181 to 221 (41 residues), 33.5 bits, see alignment 2.9e-12 amino acids 230 to 267 (38 residues), 42.7 bits, see alignment 4e-15 PF09699: Paired_CXXCH_1" amino acids 141 to 173 (33 residues), 30.6 bits, see alignment 3.3e-11 amino acids 181 to 223 (43 residues), 45.2 bits, see alignment 9e-16 amino acids 230 to 268 (39 residues), 48.7 bits, see alignment 7.4e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3017)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2V4 at UniProt or InterPro

Protein Sequence (318 amino acids)

>AMB_RS15195 cytochrome c-type protein nrfB precursor (Magnetospirillum magneticum AMB-1)
MRLARLLPWAALAAILLLAAWISPAWPQIASAPEWSADGEATCIKCHGETRDRTILFTPH
GVKGDKHTPMAQHACEGCHGASPRHNDARPPKGEKRPPTDVVFKGEFLSPVEKRNQVCSN
CHNGGEHINWKGSTHQRNDVACTDCHASHVRSDPVMAKKTEPQVCFTCHNQERAESLQAS
HHPIREGKVTCSDCHNTHGSGGPKLLKEFTLNETCYACHPEQRGPFLWEHQPVREDCSTC
HQSHGSPQSSLLKQRQPFICMTCHQTSRANHDAMVSGGQQLPGAGGVGTYNMLLARGCSN
CHSKVHGSNAPSGGMLTR