Protein Info for AMB_RS15140 in Magnetospirillum magneticum AMB-1

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 PF01627: Hpt" amino acids 15 to 109 (95 residues), 31.1 bits, see alignment E=3.4e-11 PF00072: Response_reg" amino acids 146 to 258 (113 residues), 51.4 bits, see alignment E=1.7e-17 amino acids 272 to 383 (112 residues), 82.1 bits, see alignment E=5e-27 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 396 to 555 (160 residues), 155.3 bits, see alignment E=6e-50 PF00990: GGDEF" amino acids 399 to 552 (154 residues), 140.5 bits, see alignment E=6.5e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3006)

Predicted SEED Role

"Pole remodelling regulatory diguanylate cyclase" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2W5 at UniProt or InterPro

Protein Sequence (562 amino acids)

>AMB_RS15140 transcriptional regulator (Magnetospirillum magneticum AMB-1)
MDARKPTLREKIQKLRQTFLGKVPETVRQGRDLGARLILTPKESGTLDDLYRVFHSIKGT
AASFGLEEISAKGGAGEEVLLAFRALDEDARARAVSGSVAEMNALLAQVVELAAAALDSE
NRLSALAPSFDLGLESGDDGAPRKRVYMCDDDELAAETLIIQLKCFGYAVVNFVSPDALR
AAVLSNPPDAVIMDIMFPGGSHTGTETVASLRREMPNPPPVIFISGRRDFDARLRAVMAG
GQAYFAKPVRAIELVDTLDTMTSRREPEPYRILVVDDEPEVAEYHSLILEEAGMITSLLH
EPAGILDALAAFRPDLVLMDMYMPQCTGRDLSRLIRQIPDFISLPIVFLSSETNKVTQVS
AMRVGAEAFLTKPIQPEDLISAVAIRAERMRTLRSLMVRDGLTGLFNHTFIVQYLDTALA
AARRENGKLCVAMIDVDLFKSVNDTYGHPTGDQVLVALARLLQQRLRTNDLIGRYGGEEF
VVVMQNVSLKEGMTVMNGLREDFARLKFQSGDQFFSCTFSGGISRFPEIAGDRLIEAADK
ALYEAKQAGRNRIELASLEPLP