Protein Info for AMB_RS15130 in Magnetospirillum magneticum AMB-1

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 PF01627: Hpt" amino acids 10 to 100 (91 residues), 60.1 bits, see alignment E=4.9e-20 PF02895: H-kinase_dim" amino acids 162 to 237 (76 residues), 46.2 bits, see alignment E=1.3e-15 PF02518: HATPase_c" amino acids 287 to 427 (141 residues), 64.2 bits, see alignment E=3.7e-21 PF01584: CheW" amino acids 433 to 561 (129 residues), 61.7 bits, see alignment E=1.5e-20 PF00072: Response_reg" amino acids 583 to 695 (113 residues), 85.1 bits, see alignment E=9.9e-28

Best Hits

KEGG orthology group: K03407, two-component system, chemotaxis family, sensor kinase CheA [EC: 2.7.13.3] (inferred from 100% identity to mag:amb3004)

Predicted SEED Role

"Signal transduction histidine kinase CheA (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2W7 at UniProt or InterPro

Protein Sequence (700 amino acids)

>AMB_RS15130 hybrid sensor histidine kinase/response regulator (Magnetospirillum magneticum AMB-1)
MALDIKRFTARFVDEARDHLRKVEDGLATLDSTPADSETINAVFRSAHTVKGSSRMLKLI
PITETAHKVEDVLGALRDGSLSWSPELRRLLQRGVDALSAQVDAVADGNPPAEPDPALCA
ALAAALRGPQPATEPPPAPAPASAPPAAEPPPQAEVRLKSADTVRVQLTKLDELIRLMGE
VVSSHARLRQRLTDIRQIERETQDRGEAAALTGFARDLREDVFSQELLMDELHAKALVMR
MLPLAIVLEPAARLIRDLGRSLGKDVECVVGGTEIELDRQLIDRLNDPIVHLLRNSVDHG
IEDAATRQAAGKPPFGTIRLSARQDGGWVLIEVADDGGGLPLAAIRDKAVRKGLLSAEQA
AAMPDSEAIDLIFSPGFSTSSIITEVSGRGVGMDVVKRTIVDDLQGVIGVETVPGKGTTF
ALRLPLSLAVMRVLVVSAGGESFGFTAQYVAQLLELPPERLLTVAERDAVVIDNEFIPVV
SLATLLGLPGARPARPVLRLVVVRVRNEKLALLVDELIDERDMVIKPLPEHLRHLPLVAG
MVMTGRNTLVSVLHAPVLLDMARRARGGMTEAPQSGAGDAVRILVVDDSLNTREIEKDVL
EAHGYVVTLAEDGVDGLAKARAGDFDAILTDVEMPNMDGFTLTAALRQDERYRDRPIIIV
TSREREEDKRRGIQVGADAYIVKGDFDQSSLVDTLRSLLG