Protein Info for AMB_RS15115 in Magnetospirillum magneticum AMB-1

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 661 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details PF14827: dCache_3" amino acids 64 to 292 (229 residues), 109.3 bits, see alignment E=3.8e-35 PF00672: HAMP" amino acids 326 to 374 (49 residues), 41.8 bits, see alignment 1.7e-14 PF00015: MCPsignal" amino acids 439 to 619 (181 residues), 97.6 bits, see alignment E=1.2e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3001)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2X0 at UniProt or InterPro

Protein Sequence (661 amino acids)

>AMB_RS15115 methyl-accepting chemotaxis protein (Magnetospirillum magneticum AMB-1)
MLANRDTDCNHLIKFKGRGGSGMFENLRLGVKLMLAMGAAIVVVATMLTISNLRAMEDVI
GQAERAELEGHFKAVADRILLQSRMAESLASLTAALPATQDRFAAGDRAALTAMLQPGWT
AMAQGFGVEQFQFHTPPATSFLRLHKPEKFGDDLSSFRRTVVQANETRKPARGLEGGVAG
LGIRGVVPVAKGGHHVGTVEFGLTFGQGFFDAFKAERNVDIALYLMDNGKASTFASTMGK
TPLFDAASLANAFAGTAQIMHVQVQDGPRAVYAADIADFSGTRIGVIELSMDRGRYVAAL
ADARNTALLVAALALALGLALSLSAARHLTTRIGRLSESVERVANGDLARPVVGGGADEI
GQLALAVESMRCRLHNLVGQVRSHALAAIDSIHEIDGAVEGQAATSSEMSASVAEITSTM
EELSASSTQISEHSKSVVEIANQTWEQSKRGAEAMDLVMSKMADIQHDNGNSLGEILELG
TRSKEISKVMSIINTIADQTKLIAFNAALEAASAGEAGRRFGVVAAEIRRLADSVTDSTG
EIETKVNQIQDSISRLIITSEKGGASISDGMAATSNTAGLLGGMVDAARQTTSAAQQISL
STQQQKTASSQVVVALREIVTASSHTAQSLARIREVSHEMTRLSGDLGQKVGSFSLETAG
A