Protein Info for AMB_RS14945 in Magnetospirillum magneticum AMB-1

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 11 to 133 (123 residues), 29.3 bits, see alignment E=1.7e-11 amino acids 153 to 289 (137 residues), 56.4 bits, see alignment E=9.9e-20

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to mag:amb2970)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W301 at UniProt or InterPro

Protein Sequence (294 amino acids)

>AMB_RS14945 AEC family transporter (Magnetospirillum magneticum AMB-1)
MELISGLAAVVAPVFLIAAAGFIWEKRGYPFDQGLVTNLMTLVAAPCLVFSTFTTTRISF
AEAGLMVQATLACLGLFALVAFIGLKLAGMPLRVYLPSLVFPNIGNLGLPVCLFAFGDRG
LALATVFFAVTTIGQFTLGPAVASGRFQLGAMARTPLIYAVVVALLLGGYEVPIPRWIAN
TTSLAGGMAVPLMLIALGVALAKLKAANLGRSVAMAVARLGMGVAGGWVVATFLFNLDGI
QRGVVIIESAMPVAVFNYLFAVMYDNQPEEVAGMVLTSTALALVGLPFLVAFVT