Protein Info for AMB_RS14865 in Magnetospirillum magneticum AMB-1

Annotation: ModD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR01334: modD protein" amino acids 3 to 275 (273 residues), 279.2 bits, see alignment E=2e-87 PF02749: QRPTase_N" amino acids 17 to 104 (88 residues), 71.7 bits, see alignment E=4.2e-24 PF01729: QRPTase_C" amino acids 106 to 273 (168 residues), 128.7 bits, see alignment E=1.9e-41

Best Hits

Swiss-Prot: 53% identical to MODD_RHOCA: Putative pyrophosphorylase ModD (modD) from Rhodobacter capsulatus

KEGG orthology group: K03813, molybdenum transport protein [EC: 2.4.2.-] (inferred from 100% identity to mag:amb2953)

Predicted SEED Role

"Molybdenum transport system protein ModD" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W318 at UniProt or InterPro

Protein Sequence (278 amino acids)

>AMB_RS14865 ModD protein (Magnetospirillum magneticum AMB-1)
MIRITDEELDRFFHDDVPHGDLTTRSLGLAEAPAAMAFRAGAAMVASSTEEAARLLTRLG
CAVTASVASGTRATTGDLLLVATGPAEAVLAGWKVAQTLMEYASGIASATARIVDAARAA
NPGVVVACTRKTFPGTKAVAIKAVIAGGGVPHRLGLSDSVLLFPEHRALLDDGSMADSVR
RLKQSCPEKKIVVEVTSAEEAEAAALAGADVIQLEKFTPAETAETVGRMGHYGILVAAAG
GINATNAAAYAQAGAAVLVTSAPYCAQPVDVKVAITRQ