Protein Info for AMB_RS14820 in Magnetospirillum magneticum AMB-1

Annotation: nitric oxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 10 to 36 (27 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 181 to 206 (26 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 247 to 274 (28 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details amino acids 406 to 430 (25 residues), see Phobius details PF00115: COX1" amino acids 7 to 416 (410 residues), 265 bits, see alignment E=6.2e-83

Best Hits

KEGG orthology group: K04561, nitric oxide reductase, cytochrome b-containing subunit I [EC: 1.7.2.5] (inferred from 100% identity to mag:amb2944)

MetaCyc: 66% identical to nitric oxide reductase catalytic subunit (Nitrosomonas europaea)
NITRIC-OXIDE-REDUCTASE-RXN [EC: 1.7.2.5]

Predicted SEED Role

"Nitric-oxide reductase subunit B (EC 1.7.99.7)" in subsystem Denitrification (EC 1.7.99.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.7

Use Curated BLAST to search for 1.7.2.5 or 1.7.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W327 at UniProt or InterPro

Protein Sequence (439 amino acids)

>AMB_RS14820 nitric oxide reductase (Magnetospirillum magneticum AMB-1)
MKYESQKVALYFFAGALGLFVAQILFGLVIGTIVVMPNTLSELLPFNIARMIHTNALIVW
LLMGFFGASYYLIPEEAETELYSTKLAIVQFWLFLIGAAAAVVGYLFHIHEGREFLEQPL
WIKLAIVVVALMFLFNITMTVLKGRKTAITNVLLLGLWGIAVFFLFSLYNPANLIMDKIF
WWWVVHLWVEGVWELVMASILAFLMIKLTGVDREVVEKWLYVIIGLALFSGILGTGHHYY
WIGTPGYWQWIGSVFSTLEVAPFFAMVVFAFMMVWKGGRNHPNKAALLWSLGCSVFAFFG
AGVWGFLHTLAPVNYITHGTQVTAAHGHLAFYGAYVMINIAIMTYAMPNILKREPYNQLL
NMWGFWITSSGVTFMTFALTFAGVVQSHLQRVMGMGFMEVQDQLGLFYWMRLGAGVATFI
GVVMIVWSLVVPGKAKPAQ