Protein Info for AMB_RS14815 in Magnetospirillum magneticum AMB-1
Annotation: CbbQ/NirQ/NorQ/GpvN family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to NORQ_PARDP: Protein NorQ (norQ) from Paracoccus denitrificans (strain Pd 1222)
KEGG orthology group: K04748, nitric oxide reductase NorQ protein (inferred from 100% identity to mag:amb2943)Predicted SEED Role
"Nitric oxide reductase activation protein NorQ" in subsystem Denitrification
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W328 at UniProt or InterPro
Protein Sequence (260 amino acids)
>AMB_RS14815 CbbQ/NirQ/NorQ/GpvN family protein (Magnetospirillum magneticum AMB-1) MSESLPFYLPQGNECALFELAWRHRLPLLLKGPTGCGKTRFVAHMAARLGRSLFTVSCHD DLTAADLTGRYLLKGGDTVWTDGPLTSAVRSGGVCYLDEVVEARKDVTVVLHPLTDDRRI LPLERTGEMLAAPPEFMLVASYNPGYQNVLKQLKPSTRQRFMAIEFDFPAPDLERRVVAE ESGLEEGKVQALILLAQRLRALKGHDLEEGVSTRLLVYCATLMQAGLAVRDAVQVTMVEP LSDDPEVKAGLEEVVKAIFG